Lineage for d2b11b1 (2b11 B:296-403)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719846Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1719847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
    Uniprot P00044
  8. 1719894Domain d2b11b1: 2b11 B:296-403 [144945]
    Other proteins in same PDB: d2b11a_, d2b11c_
    complexed with hem, znh

Details for d2b11b1

PDB Entry: 2b11 (more details), 2.3 Å

PDB Description: crystal structure of the protein-protein complex between f82w cytochrome c and cytochrome c peroxidase
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2b11b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b11b1 a.3.1.1 (B:296-403) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmawgglkkekdrndlitylkkace

SCOPe Domain Coordinates for d2b11b1:

Click to download the PDB-style file with coordinates for d2b11b1.
(The format of our PDB-style files is described here.)

Timeline for d2b11b1: