SCOPe 2.01: Domain d2b0zb1: 2b0z B:-4-103

Lineage for d2b0zb1 (2b0z B:-4-103)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (45 PDB entries)
   Uniprot P00044

8. Domain d2b0zb1: 2b0z B:-4-103 [144942]
   Other proteins in same PDB: d2b0za_
   complexed with hem, znh

Details for d2b0zb1

PDB Entry: 2b0z, 2.7 Å

PDB Description: crystal structure of the protein-protein complex between f82i cytochrome c and cytochrome c peroxidase

PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2b0zb1:

Sequence; same for both SEQRES and ATOM records:

>d2b0zb1 a.3.1.1 (B:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmaigglkkekdrndlitylkkace

Timeline for d2b0zb1:

• d2b0zb1 first appeared in SCOP 1.75
  
• d2b0zb1 appears in SCOPe 2.02
  
• d2b0zb1 appears in the current release, SCOPe 2.08