![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
![]() | Family f.23.34.1: PsbT-like [161030] (1 protein) Pfam PF01405 |
![]() | Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161032] (7 PDB entries) Uniprot Q8DIQ0 1-30 |
![]() | Domain d2axtt1: 2axt T:1-30 [144939] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axtt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtt1 f.23.34.1 (T:1-30) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]} metityvfifaciialfffaiffrepprit
Timeline for d2axtt1: