Lineage for d2axtm1 (2axt M:1-36)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1060197Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
  5. 1060198Family f.23.35.1: PsbM-like [161034] (1 protein)
    Pfam PF05151
  6. 1060199Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 1060200Species Thermosynechococcus elongatus [TaxId:146786] [161036] (3 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 1060201Domain d2axtm1: 2axt M:1-36 [144937]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtm1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (M:) Photosystem II reaction center M protein

SCOPe Domain Sequences for d2axtm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtm1 f.23.35.1 (M:1-36) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqqkss

SCOPe Domain Coordinates for d2axtm1:

Click to download the PDB-style file with coordinates for d2axtm1.
(The format of our PDB-style files is described here.)

Timeline for d2axtm1: