Lineage for d2axtl1 (2axt L:1-37)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1060159Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
  5. 1060160Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 1060161Protein Photosystem II reaction center protein L, PsbL [161019] (1 species)
  7. 1060162Species Thermosynechococcus elongatus [TaxId:146786] [161020] (1 PDB entry)
    Uniprot Q8DIN8 1-37
  8. 1060163Domain d2axtl1: 2axt L:1-37 [144936]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtl1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (L:) Photosystem II reaction center L protein

SCOPe Domain Sequences for d2axtl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtl1 f.23.31.1 (L:1-37) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d2axtl1:

Click to download the PDB-style file with coordinates for d2axtl1.
(The format of our PDB-style files is described here.)

Timeline for d2axtl1: