| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
| Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
| Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161040] (5 PDB entries) Uniprot Q9F1K9 10-46 |
| Domain d2axtk1: 2axt K:10-46 [144935] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axtk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtk1 f.23.36.1 (K:10-46) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d2axtk1: