![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
![]() | Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
![]() | Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries) Uniprot Q8DJ43 2-65 |
![]() | Domain d2axth1: 2axt H:2-65 [144932] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axth1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axth1 f.23.33.1 (H:2-65) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkal
Timeline for d2axth1: