![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
![]() | Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
![]() | Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161050] (2 PDB entries) Uniprot Q8DIN9 11-45 |
![]() | Domain d2axtf1: 2axt F:11-45 [144931] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axtf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtf1 f.23.38.1 (F:11-45) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus elongatus [TaxId: 146786]} vsypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d2axtf1: