![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
![]() | Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) ![]() |
![]() | Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
![]() | Protein Photosystem II CP43 protein PsbC [161081] (1 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161082] (1 PDB entry) Uniprot Q8DIF8 15-461 |
![]() | Domain d2axtc1: 2axt C:27-473 [144928] Other proteins in same PDB: d2axta1, d2axtb1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtc1 f.55.1.1 (C:27-473) Photosystem II CP43 protein PsbC {Thermosynechococcus elongatus [TaxId: 146786]} dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag raraaaagfekgidresepvlsmpsld
Timeline for d2axtc1: