Lineage for d2axtc1 (2axt C:27-473)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1061154Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 1061155Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
  5. 1061156Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 1061160Protein Photosystem II CP43 protein PsbC [161081] (1 species)
  7. 1061161Species Thermosynechococcus elongatus [TaxId:146786] [161082] (1 PDB entry)
    Uniprot Q8DIF8 15-461
  8. 1061162Domain d2axtc1: 2axt C:27-473 [144928]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtc1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (C:) Photosystem II CP43 protein

SCOPe Domain Sequences for d2axtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtc1 f.55.1.1 (C:27-473) Photosystem II CP43 protein PsbC {Thermosynechococcus elongatus [TaxId: 146786]}
dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl
iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf
fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp
rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw
sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga
nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp
wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag
raraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d2axtc1:

Click to download the PDB-style file with coordinates for d2axtc1.
(The format of our PDB-style files is described here.)

Timeline for d2axtc1: