Lineage for d2axtb1 (2axt B:2-489)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1061154Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 1061155Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
  5. 1061156Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 1061157Protein Photosystem II core light harvesting protein PsbB [161079] (1 species)
  7. 1061158Species Thermosynechococcus elongatus [TaxId:146786] [161080] (1 PDB entry)
    Uniprot Q8DIQ1 2-489
  8. 1061159Domain d2axtb1: 2axt B:2-489 [144927]
    Other proteins in same PDB: d2axta1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtb1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (B:) CP47 protein

SCOPe Domain Sequences for d2axtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtb1 f.55.1.1 (B:2-489) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspe

SCOPe Domain Coordinates for d2axtb1:

Click to download the PDB-style file with coordinates for d2axtb1.
(The format of our PDB-style files is described here.)

Timeline for d2axtb1: