SCOP 1.75: Domain d2awbi2: 2awb I:1-72

Lineage for d2awbi2 (2awb I:1-72)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
   Uniprot P0A7J7 1-72

8. Domain d2awbi2: 2awb I:1-72 [144916]
   Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1
   automatically matched to 2AW4 I:1-72
   complexed with mg

Details for d2awbi2

PDB Entry: 2awb, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOP Domain Sequences for d2awbi2:

Sequence; same for both SEQRES and ATOM records:

>d2awbi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

Timeline for d2awbi2:

• d2awbi2 is new in SCOP 1.75
  
• d2awbi2 appears in SCOPe 2.01
  
• d2awbi2 appears in the current release, SCOPe 2.08