SCOP 1.75: Domain d2awbh2: 2awb H:1-58

Lineage for d2awbh2 (2awb H:1-58)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (2 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d2awbh2: 2awb H:1-58 [144914]
   Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbi1, d2awbi2, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1
   automatically matched to 2AW4 H:1-58
   complexed with mg

Details for d2awbh2

PDB Entry: 2awb, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L9

SCOP Domain Sequences for d2awbh2:

Sequence; same for both SEQRES and ATOM records:

>d2awbh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d2awbh2:

• d2awbh2 is new in SCOP 1.75
  
• d2awbh2 appears in SCOPe 2.01
  
• d2awbh2 appears in the current release, SCOPe 2.08