Lineage for d2awbc1 (2awb C:125-269)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310711Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1310874Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 1310875Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 1310885Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 1310903Domain d2awbc1: 2awb C:125-269 [144906]
    Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbi2, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1
    automatically matched to 2AW4 C:125-269
    protein/RNA complex; complexed with mg

Details for d2awbc1

PDB Entry: 2awb (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2awbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awbc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOPe Domain Coordinates for d2awbc1:

Click to download the PDB-style file with coordinates for d2awbc1.
(The format of our PDB-style files is described here.)

Timeline for d2awbc1: