SCOP 1.75: Domain d2aw7u1: 2aw7 U:3-53

Lineage for d2aw7u1 (2aw7 U:3-53)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2aw7u1: 2aw7 U:3-53 [144905]
   Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1
   automatically matched to 2AVY U:3-53
   complexed with mg

Details for d2aw7u1

PDB Entry: 2aw7, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOP Domain Sequences for d2aw7u1:

Sequence; same for both SEQRES and ATOM records:

>d2aw7u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2aw7u1:

• d2aw7u1 is new in SCOP 1.75
  
• d2aw7u1 appears in SCOPe 2.01
  
• d2aw7u1 appears in the current release, SCOPe 2.08