Lineage for d2aw7p1 (2aw7 P:1-80)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857884Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 857885Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 857886Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 857887Protein Ribosomal protein S16 [54567] (3 species)
  7. 857890Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 857904Domain d2aw7p1: 2aw7 P:1-80 [144900]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    automatically matched to 2AVY P:1-82
    complexed with mg

Details for d2aw7p1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d2aw7p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7p1 d.27.1.1 (P:1-80) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnk

SCOP Domain Coordinates for d2aw7p1:

Click to download the PDB-style file with coordinates for d2aw7p1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7p1: