Lineage for d2aw7j1 (2aw7 J:5-102)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206381Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 1206382Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1206383Protein Ribosomal protein S10 [55001] (2 species)
  7. 1206384Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 1206396Domain d2aw7j1: 2aw7 J:5-102 [144894]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    automatically matched to 2AVY J:5-102
    protein/RNA complex; complexed with mg

Details for d2aw7j1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2aw7j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7j1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOPe Domain Coordinates for d2aw7j1:

Click to download the PDB-style file with coordinates for d2aw7j1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7j1: