Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Escherichia coli [TaxId:562] [159907] (26 PDB entries) Uniprot P0A7X3 3-129 |
Domain d2aw7i1: 2aw7 I:3-129 [144893] Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1 automatically matched to 2AVY I:3-129 complexed with mg |
PDB Entry: 2aw7 (more details), 3.46 Å
SCOP Domain Sequences for d2aw7i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw7i1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr rpqfskr
Timeline for d2aw7i1: