Lineage for d2aw7g1 (2aw7 G:2-151)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918656Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 918657Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 918658Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 918659Protein Ribosomal protein S7 [47975] (4 species)
  7. 918662Species Escherichia coli [TaxId:562] [158599] (24 PDB entries)
    Uniprot P02359 2-151
  8. 918674Domain d2aw7g1: 2aw7 G:2-151 [144892]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    automatically matched to 2AVY G:2-151
    protein/RNA complex; complexed with mg

Details for d2aw7g1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2aw7g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7g1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]}
rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
elsdaaenkgtavkkredvhrmaeankafa

SCOPe Domain Coordinates for d2aw7g1:

Click to download the PDB-style file with coordinates for d2aw7g1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7g1: