SCOPe 2.08: Domain d2aw7e1: 2aw7 E:78-158

Lineage for d2aw7e1 (2aw7 E:78-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d2aw7e1: 2aw7 E:78-158 [144889]
   Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2aw7e1

PDB Entry: 2aw7, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2aw7e1:

Sequence; same for both SEQRES and ATOM records:

>d2aw7e1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d2aw7e1:

• d2aw7e1 first appeared in SCOP 1.75
  
• d2aw7e1 appears in SCOPe 2.07