SCOPe 2.03: Domain d2aw7c1: 2aw7 C:1-105

Lineage for d2aw7c1 (2aw7 C:1-105)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
   Uniprot P0A7V3 1-105

8. Domain d2aw7c1: 2aw7 C:1-105 [144886]
   Other proteins in same PDB: d2aw7b1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
   automatically matched to 2AVY C:1-105
   protein/RNA complex; complexed with mg

Details for d2aw7c1

PDB Entry: 2aw7, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2aw7c1:

Sequence; same for both SEQRES and ATOM records:

>d2aw7c1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

Timeline for d2aw7c1:

• d2aw7c1 first appeared in SCOP 1.75
  
• d2aw7c1 appears in SCOPe 2.02
  
• d2aw7c1 appears in SCOPe 2.04
  
• d2aw7c1 appears in the current release, SCOPe 2.08