Lineage for d2aw7b1 (2aw7 B:8-225)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826781Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 826782Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 826783Protein Ribosomal protein S2 [52315] (3 species)
  7. 826793Species Escherichia coli [TaxId:562] [159491] (26 PDB entries)
    Uniprot P0A7V0 8-225
  8. 826807Domain d2aw7b1: 2aw7 B:8-225 [144885]
    Other proteins in same PDB: d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    automatically matched to 2AVY B:8-225
    complexed with mg

Details for d2aw7b1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOP Domain Sequences for d2aw7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs

SCOP Domain Coordinates for d2aw7b1:

Click to download the PDB-style file with coordinates for d2aw7b1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7b1: