Lineage for d2aw2x_ (2aw2 X:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929308Protein B- and T-lymphocyte attenuator CD272 [158869] (1 species)
  7. 929309Species Human (Homo sapiens) [TaxId:9606] [158870] (1 PDB entry)
    Uniprot Q7Z6A9 34-137
  8. 929311Domain d2aw2x_: 2aw2 X: [144864]
    Other proteins in same PDB: d2aw2b1, d2aw2b2, d2aw2y1, d2aw2y2
    automated match to d2aw2a1
    complexed with ni

Details for d2aw2x_

PDB Entry: 2aw2 (more details), 2.8 Å

PDB Description: Crystal structure of the human BTLA-HVEM complex
PDB Compounds: (X:) B and T lymphocyte attenuator

SCOPe Domain Sequences for d2aw2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw2x_ b.1.1.1 (X:) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]}
cdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeek
nisffilhfepvlpndngsyrcsanfqsnlieshsttlyvtdvkhhh

SCOPe Domain Coordinates for d2aw2x_:

Click to download the PDB-style file with coordinates for d2aw2x_.
(The format of our PDB-style files is described here.)

Timeline for d2aw2x_: