SCOP 1.75: Domain d2avyu1: 2avy U:3-53

Lineage for d2avyu1 (2avy U:3-53)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2avyu1: 2avy U:3-53 [144862]
   Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1
   Representative structure
   complexed with mg

Details for d2avyu1

PDB Entry: 2avy, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOP Domain Sequences for d2avyu1:

Sequence; same for both SEQRES and ATOM records:

>d2avyu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2avyu1:

• d2avyu1 is new in SCOP 1.75
  
• d2avyu1 appears in SCOPe 2.01
  
• d2avyu1 appears in the current release, SCOPe 2.08