![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
![]() | Domain d2avyq1: 2avy Q:3-82 [144858] Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyr1, d2avys1, d2avyt1, d2avyu1 Representative structure complexed with mg |
PDB Entry: 2avy (more details), 3.46 Å
SCOP Domain Sequences for d2avyq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avyq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire crplsktkswtlvrvvekav
Timeline for d2avyq1: