Lineage for d2avyp1 (2avy P:1-82)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857884Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 857885Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 857886Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 857887Protein Ribosomal protein S16 [54567] (3 species)
  7. 857890Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 857903Domain d2avyp1: 2avy P:1-82 [144857]
    Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
    Representative structure
    complexed with mg

Details for d2avyp1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d2avyp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avyp1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnkaa

SCOP Domain Coordinates for d2avyp1:

Click to download the PDB-style file with coordinates for d2avyp1.
(The format of our PDB-style files is described here.)

Timeline for d2avyp1: