Lineage for d2avyn1 (2avy N:1-100)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244607Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1244608Protein Ribosomal protein S14 [57753] (2 species)
  7. 1244609Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
    Uniprot P02370 1-100
  8. 1244620Domain d2avyn1: 2avy N:1-100 [144855]
    Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
    Representative structure
    protein/RNA complex; complexed with mg

Details for d2avyn1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2avyn1:

Sequence, based on SEQRES records: (download)

>d2avyn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records): (download)

>d2avyn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

SCOPe Domain Coordinates for d2avyn1:

Click to download the PDB-style file with coordinates for d2avyn1.
(The format of our PDB-style files is described here.)

Timeline for d2avyn1: