Lineage for d2arjl1 (2arj L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741585Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (14 PDB entries)
  8. 2741599Domain d2arjl1: 2arj L:1-107 [144835]
    Other proteins in same PDB: d2arja2, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl2, d2arjq_, d2arjr_
    automated match to d2arja1

Details for d2arjl1

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (L:) YTS 105.18 antigen binding region Light chain

SCOPe Domain Sequences for d2arjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arjl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
divmtqspsslavsagervtlnckasqnvrnniawyqqkpgqspklliyyasyrytgvpd
rftgdgfgtdftlainsvqaddaafyycqriynspytfgagtkleli

SCOPe Domain Coordinates for d2arjl1:

Click to download the PDB-style file with coordinates for d2arjl1.
(The format of our PDB-style files is described here.)

Timeline for d2arjl1: