Lineage for d2arjh2 (2arj H:114-228)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2748487Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries)
  8. 2748495Domain d2arjh2: 2arj H:114-228 [144834]
    Other proteins in same PDB: d2arja1, d2arja2, d2arjb1, d2arjh1, d2arjl1, d2arjl2, d2arjq_, d2arjr_
    automated match to d2arjb2

Details for d2arjh2

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (H:) YTS 105.18 antigen binding region Heavy chain

SCOPe Domain Sequences for d2arjh2:

Sequence, based on SEQRES records: (download)

>d2arjh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdqkivpr

Sequence, based on observed residues (ATOM records): (download)

>d2arjh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
ltssvtsstwpsqtvtcnvahpasstkvdqkivpr

SCOPe Domain Coordinates for d2arjh2:

Click to download the PDB-style file with coordinates for d2arjh2.
(The format of our PDB-style files is described here.)

Timeline for d2arjh2: