Lineage for d2arjb2 (2arj B:114-228)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933318Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 934135Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries)
  8. 934144Domain d2arjb2: 2arj B:114-228 [144832]
    Other proteins in same PDB: d2arja1, d2arja2, d2arjb1, d2arjh1, d2arjl1, d2arjl2, d2arjq_, d2arjr_

Details for d2arjb2

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (B:) YTS 105.18 antigen binding region Heavy chain

SCOPe Domain Sequences for d2arjb2:

Sequence, based on SEQRES records: (download)

>d2arjb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdqkivpr

Sequence, based on observed residues (ATOM records): (download)

>d2arjb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
ltssvtsstwpsqtvtcnvahpasstkvdqkivpr

SCOPe Domain Coordinates for d2arjb2:

Click to download the PDB-style file with coordinates for d2arjb2.
(The format of our PDB-style files is described here.)

Timeline for d2arjb2: