Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries) |
Domain d2arja2: 2arj A:108-211 [144830] Other proteins in same PDB: d2arja1, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjq1, d2arjr1 |
PDB Entry: 2arj (more details), 2.88 Å
SCOP Domain Sequences for d2arja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arja2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsmeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnr
Timeline for d2arja2: