Lineage for d2arja2 (2arj A:108-211)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786696Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries)
  8. 786705Domain d2arja2: 2arj A:108-211 [144830]
    Other proteins in same PDB: d2arja1, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjq1, d2arjr1

Details for d2arja2

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (A:) YTS 105.18 antigen binding region Light chain

SCOP Domain Sequences for d2arja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arja2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsmeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnr

SCOP Domain Coordinates for d2arja2:

Click to download the PDB-style file with coordinates for d2arja2.
(The format of our PDB-style files is described here.)

Timeline for d2arja2: