| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (16 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries) |
| Domain d2aq3c_: 2aq3 C: [144826] Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3b2, d2aq3d1, d2aq3d2, d2aq3f1, d2aq3f2, d2aq3h1, d2aq3h2 automated match to d2aq3a1 |
PDB Entry: 2aq3 (more details), 2.3 Å
SCOPe Domain Sequences for d2aq3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq3c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
Timeline for d2aq3c_: