Lineage for d2aq3c1 (2aq3 C:2-117)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783866Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
  8. 783896Domain d2aq3c1: 2aq3 C:2-117 [144826]
    Other proteins in same PDB: d2aq3b1, d2aq3b2, d2aq3d1, d2aq3d2, d2aq3f1, d2aq3f2, d2aq3h1, d2aq3h2
    automatically matched to 2AQ3 A:2-117
    mutant

Details for d2aq3c1

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (C:) T-cell receptor beta chain V

SCOP Domain Sequences for d2aq3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3c1 b.1.1.1 (C:2-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOP Domain Coordinates for d2aq3c1:

Click to download the PDB-style file with coordinates for d2aq3c1.
(The format of our PDB-style files is described here.)

Timeline for d2aq3c1: