Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries) |
Domain d2ak4i1: 2ak4 I:1-116 [144812] Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d2, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4i2, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n2, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r1, d2ak4t2, d2ak4u2 automatically matched to 2AK4 D:1-116 complexed with iod |
PDB Entry: 2ak4 (more details), 2.5 Å
SCOP Domain Sequences for d2ak4i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak4i1 b.1.1.1 (I:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} qkvtqaqteisvvekedvtldcvyetrdttyylfwykqppsgelvflirrnsfdeqneis gryswnfqkstssfnftitasqvvdsavyfcalsgfyntdklifgtgtrlqvfp
Timeline for d2ak4i1:
View in 3D Domains from other chains: (mouse over for more information) d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4j1, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r1, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2 |