Lineage for d2ak4e1 (2ak4 E:3-118)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783750Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 783763Domain d2ak4e1: 2ak4 E:3-118 [144810]
    Other proteins in same PDB: d2ak4a1, d2ak4a2, d2ak4b1, d2ak4d2, d2ak4e2, d2ak4f1, d2ak4f2, d2ak4g1, d2ak4i2, d2ak4j2, d2ak4k1, d2ak4k2, d2ak4l1, d2ak4n2, d2ak4p2, d2ak4q1, d2ak4q2, d2ak4r1, d2ak4t2, d2ak4u2
    complexed with iod

Details for d2ak4e1

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (E:) SB27 T cell receptor beta chain

SCOP Domain Sequences for d2ak4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak4e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcaspglageyeqyfgpgtrltvte

SCOP Domain Coordinates for d2ak4e1:

Click to download the PDB-style file with coordinates for d2ak4e1.
(The format of our PDB-style files is described here.)

Timeline for d2ak4e1: