SCOPe 2.02: Domain d2agjh2: 2agj H:121-226

Lineage for d2agjh2 (2agj H:121-226)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)

8. Domain d2agjh2: 2agj H:121-226 [144807]
   Other proteins in same PDB: d2agjh1, d2agjl1, d2agjl2

Details for d2agjh2

PDB Entry: 2agj, 2.6 Å

PDB Description: crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody

PDB Compounds: (H:) Yvo Fab, Heavy Chain

SCOPe Domain Sequences for d2agjh2:

Sequence; same for both SEQRES and ATOM records:

>d2agjh2 b.1.1.2 (H:121-226) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscensspsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvmqgtdehvvckvqhpngnkekdvplpvvi

Timeline for d2agjh2:

• d2agjh2 first appeared in SCOP 1.75
  
• d2agjh2 appears in SCOPe 2.01
  
• d2agjh2 appears in SCOPe 2.03
  
• d2agjh2 appears in the current release, SCOPe 2.08