Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries) |
Domain d2agjh2: 2agj H:121-226 [144807] Other proteins in same PDB: d2agjh1, d2agjl1, d2agjl2 complexed with nag |
PDB Entry: 2agj (more details), 2.6 Å
SCOP Domain Sequences for d2agjh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2agjh2 b.1.1.2 (H:121-226) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} gsasaptlfplvscensspsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr ggkyaatsqvllpskdvmqgtdehvvckvqhpngnkekdvplpvvi
Timeline for d2agjh2: