Lineage for d2agjh2 (2agj H:121-226)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786030Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 786031Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)
  8. 786039Domain d2agjh2: 2agj H:121-226 [144807]
    Other proteins in same PDB: d2agjh1, d2agjl1, d2agjl2
    complexed with nag

Details for d2agjh2

PDB Entry: 2agj (more details), 2.6 Å

PDB Description: crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody
PDB Compounds: (H:) Yvo Fab, Heavy Chain

SCOP Domain Sequences for d2agjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agjh2 b.1.1.2 (H:121-226) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscensspsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvmqgtdehvvckvqhpngnkekdvplpvvi

SCOP Domain Coordinates for d2agjh2:

Click to download the PDB-style file with coordinates for d2agjh2.
(The format of our PDB-style files is described here.)

Timeline for d2agjh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2agjh1