SCOPe 2.05: Domain d2agjh1: 2agj H:1-120

Lineage for d2agjh1 (2agj H:1-120)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (68 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d2agjh1: 2agj H:1-120 [144806]
   Other proteins in same PDB: d2agjh2, d2agjl1, d2agjl2
   annotated as human, this domain has greater sequence similarity to mouse VH domains

Details for d2agjh1

PDB Entry: 2agj, 2.6 Å

PDB Description: crystal structure of a glycosylated fab from an igm cryoglobulin with properties of a natural proteolytic antibody

PDB Compounds: (H:) Yvo Fab, Heavy Chain

SCOPe Domain Sequences for d2agjh1:

Sequence; same for both SEQRES and ATOM records:

>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evtlkesgptlvkptqtltltctfsgfsltttgegvgwirqppgkaleflafiywndakr
ynpslqsrltitkdaskkqvvltltnldpvdtatyycartsgwdiefeywgqgtlvtvss

Timeline for d2agjh1:

• d2agjh1 first appeared in SCOP 1.75
  
• d2agjh1 appears in SCOPe 2.04
  
• d2agjh1 appears in SCOPe 2.06
  
• d2agjh1 appears in the current release, SCOPe 2.08