Lineage for d2aabl1 (2aab L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511857Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 1511872Domain d2aabl1: 2aab L:1-107 [144795]
    Other proteins in same PDB: d2aabh1, d2aabl2

Details for d2aabl1

PDB Entry: 2aab (more details), 2.5 Å

PDB Description: Structural basis of antigen mimicry in a clinically relevant melanoma antigen system
PDB Compounds: (L:) anti-idiotypic monoclonal antibody (light chain)

SCOPe Domain Sequences for d2aabl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aabl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
diqltqspaslavslgqrvtiscrasesveyygsslmqwyqqkpgqppklliyaasnves
gvparfsgsgsgtdfslnihpveeddiamyfcqqsrkipytfgggtkleik

SCOPe Domain Coordinates for d2aabl1:

Click to download the PDB-style file with coordinates for d2aabl1.
(The format of our PDB-style files is described here.)

Timeline for d2aabl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aabl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2aabh1