Lineage for d2a5fb_ (2a5f B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2233862Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2233881Protein Cholera toxin [56410] (1 species)
  7. 2233882Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries)
  8. 2233887Domain d2a5fb_: 2a5f B: [144784]
    Other proteins in same PDB: d2a5fa_
    automated match to d2a5db1
    complexed with gol, gtp, mg, na, nad

Details for d2a5fb_

PDB Entry: 2a5f (more details), 2.02 Å

PDB Description: cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6
PDB Compounds: (B:) Cholera enterotoxin, A chain

SCOPe Domain Sequences for d2a5fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5fb_ d.166.1.1 (B:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
dklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyvst
sislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggipys
qiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihh
appgs

SCOPe Domain Coordinates for d2a5fb_:

Click to download the PDB-style file with coordinates for d2a5fb_.
(The format of our PDB-style files is described here.)

Timeline for d2a5fb_: