SCOPe 2.07: Domain d2a5db1: 2a5d B:1-186

Lineage for d2a5db1 (2a5d B:1-186)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Cholera toxin [56410] (1 species)

7. Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries)

8. Domain d2a5db1: 2a5d B:1-186 [144783]
   Other proteins in same PDB: d2a5da_
   complexed with gol, gtp, mg, na

Details for d2a5db1

PDB Entry: 2a5d, 1.8 Å

PDB Description: structural basis for the activation of cholera toxin by human arf6-gtp

PDB Compounds: (B:) Cholera enterotoxin, A chain

SCOPe Domain Sequences for d2a5db1:

Sequence; same for both SEQRES and ATOM records:

>d2a5db1 d.166.1.1 (B:1-186) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappg

Timeline for d2a5db1:

• d2a5db1 first appeared in SCOP 1.75
  
• d2a5db1 appears in SCOPe 2.06
  
• d2a5db1 appears in the current release, SCOPe 2.08