Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [160074] (1 PDB entry) |
Domain d1zvsd2: 1zvs D:1-181 [144776] Other proteins in same PDB: d1zvsa1, d1zvsb_, d1zvsd1, d1zvse_ automatically matched to 1ZVS A:1-181 |
PDB Entry: 1zvs (more details), 2.8 Å
SCOPe Domain Sequences for d1zvsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvsd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} gshsmkyfytsmsrpgrgqprfiavgyvddtqfvrfdsdaasqrmeprapwveqegpeyw dretrnmktetqnapvnlrtllryynqseagshtlqrmvgcdlgpdgrllrgyeqyaydg kdyialnedlrswtaadvaaqntqrkweaadvaesmraylegqcvewlprylekgketlq r
Timeline for d1zvsd2:
View in 3D Domains from other chains: (mouse over for more information) d1zvsa1, d1zvsa2, d1zvsb_, d1zvse_ |