| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [160074] (1 PDB entry) |
| Domain d1zvsa2: 1zvs A:1-181 [144774] Other proteins in same PDB: d1zvsa1, d1zvsb1, d1zvsd1, d1zvse1 |
PDB Entry: 1zvs (more details), 2.8 Å
SCOP Domain Sequences for d1zvsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvsa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
gshsmkyfytsmsrpgrgqprfiavgyvddtqfvrfdsdaasqrmeprapwveqegpeyw
dretrnmktetqnapvnlrtllryynqseagshtlqrmvgcdlgpdgrllrgyeqyaydg
kdyialnedlrswtaadvaaqntqrkweaadvaesmraylegqcvewlprylekgketlq
r
Timeline for d1zvsa2:
View in 3DDomains from other chains: (mouse over for more information) d1zvsb1, d1zvsd1, d1zvsd2, d1zvse1 |