Lineage for d1zvsa1 (1zvs A:182-278)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1107074Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [158875] (1 PDB entry)
  8. 1107075Domain d1zvsa1: 1zvs A:182-278 [144773]
    Other proteins in same PDB: d1zvsa2, d1zvsb_, d1zvsd2, d1zvse_

Details for d1zvsa1

PDB Entry: 1zvs (more details), 2.8 Å

PDB Description: Crystal structure of the first class MHC mamu and Tat-Tl8 complex
PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d1zvsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvsa1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
tdppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkphtlkwephh

SCOPe Domain Coordinates for d1zvsa1:

Click to download the PDB-style file with coordinates for d1zvsa1.
(The format of our PDB-style files is described here.)

Timeline for d1zvsa1: