Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [158875] (1 PDB entry) |
Domain d1zvsa1: 1zvs A:182-276 [144773] Other proteins in same PDB: d1zvsa2, d1zvsa3, d1zvsb_, d1zvsd2, d1zvsd3, d1zvse_ |
PDB Entry: 1zvs (more details), 2.8 Å
SCOPe Domain Sequences for d1zvsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvsa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} tdppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpkphtlkwep
Timeline for d1zvsa1: