| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
| Domain d1zt7c1: 1zt7 C:181-275 [144769] Other proteins in same PDB: d1zt7a2, d1zt7b1, d1zt7c2, d1zt7d1 automatically matched to 1ZT1 A:181-276 |
PDB Entry: 1zt7 (more details), 3 Å
SCOPe Domain Sequences for d1zt7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt7c1 b.1.1.2 (C:181-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
rtdspkahvtrhsrpedkvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwasvvvplgkeqyytchvyhqglpepltlrwe
Timeline for d1zt7c1:
View in 3DDomains from other chains: (mouse over for more information) d1zt7a1, d1zt7a2, d1zt7b1, d1zt7d1 |