Lineage for d1zt4c1 (1zt4 C:184-281)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766392Domain d1zt4c1: 1zt4 C:184-281 [144765]
    Other proteins in same PDB: d1zt4a1, d1zt4a2, d1zt4b_, d1zt4c2, d1zt4d_
    automated match to d3hujc2
    complexed with agh

Details for d1zt4c1

PDB Entry: 1zt4 (more details), 3 Å

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide
PDB Compounds: (C:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt4c1 b.1.1.0 (C:184-281) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywggsy

SCOPe Domain Coordinates for d1zt4c1:

Click to download the PDB-style file with coordinates for d1zt4c1.
(The format of our PDB-style files is described here.)

Timeline for d1zt4c1: