SCOPe 2.01: Domain d1zt1a2: 1zt1 A:1-176

Lineage for d1zt1a2 (1zt1 A:1-176)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2KK [TaxId:10090] [160075] (2 PDB entries)
   Uniprot P04223 22-197

8. Domain d1zt1a2: 1zt1 A:1-176 [144762]
   Other proteins in same PDB: d1zt1a1, d1zt1b_
   complexed with cl

Details for d1zt1a2

PDB Entry: 1zt1, 2.5 Å

PDB Description: crystal structure of class i mhc h-2kk in complex with an octapeptide

PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-K alpha chain

SCOPe Domain Sequences for d1zt1a2:

Sequence; same for both SEQRES and ATOM records:

>d1zt1a2 d.19.1.1 (A:1-176) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KK [TaxId: 10090]}
gphslryfhtavsrpglgkprfisvgyvddtqfvrfdsdaenpryeprvrwmeqvepeyw
erntqiakgneqifrvnlrtalryynqsaggshtfqrmygcevgsdwrllrgyeqyaydg
cdyialnedlktwtaadmaalitkhkweqagdaerdraylegtcvewlrrylqlgn

Timeline for d1zt1a2:

• d1zt1a2 first appeared in SCOP 1.75
  
• d1zt1a2 appears in SCOPe 2.02
  
• d1zt1a2 appears in the current release, SCOPe 2.08