Lineage for d1zs8c1 (1zs8 C:181-274)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291448Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1291720Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
    Uniprot P01901 22-299
  8. 1291884Domain d1zs8c1: 1zs8 C:181-274 [144751]
    Other proteins in same PDB: d1zs8a2, d1zs8b1, d1zs8c2, d1zs8d1, d1zs8e2, d1zs8f1, d1zs8g2, d1zs8h1, d1zs8i2, d1zs8j1
    automatically matched to 1ZS8 A:181-274
    complexed with nag

Details for d1zs8c1

PDB Entry: 1zs8 (more details), 3 Å

PDB Description: crystal structure of the murine mhc class ib molecule m10.5
PDB Compounds: (C:) histocompatibility 2, M region locus 10.5

SCOPe Domain Sequences for d1zs8c1:

Sequence, based on SEQRES records: (download)

>d1zs8c1 b.1.1.2 (C:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
sdaprthvthkvtpegnvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtf
qkwaavvvpfgeelrytchvhheglpgpltlkwg

Sequence, based on observed residues (ATOM records): (download)

>d1zs8c1 b.1.1.2 (C:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
sdaprthvthkvtvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtfqkwa
avvvpfgeelrytchvhheglpgpltlkwg

SCOPe Domain Coordinates for d1zs8c1:

Click to download the PDB-style file with coordinates for d1zs8c1.
(The format of our PDB-style files is described here.)

Timeline for d1zs8c1: