SCOPe 2.03: Domain d1zr0d_: 1zr0 D:

Lineage for d1zr0d_ (1zr0 D:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Tissue factor pathway inhibitor [57368] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)

8. Domain d1zr0d_: 1zr0 D: [144748]
   Other proteins in same PDB: d1zr0a_, d1zr0c_
   automated match to d1zr0b1
   complexed with ca

Details for d1zr0d_

PDB Entry: 1zr0, 1.8 Å

PDB Description: Crystal Structure of Kunitz Domain 1 of Tissue Factor Pathway Inhibitor-2 with Bovine Trypsin

PDB Compounds: (D:) Tissue factor pathway inhibitor 2

SCOPe Domain Sequences for d1zr0d_:

Sequence; same for both SEQRES and ATOM records:

>d1zr0d_ g.8.1.1 (D:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
ptgnnaeicllpldygpcralllryyydrytqscrqflyggcegnannfytweacddacw
rie

Timeline for d1zr0d_:

• d1zr0d_ first appeared in SCOP 1.75, called d1zr0d1
  
• d1zr0d_ appears in SCOPe 2.02
  
• d1zr0d_ appears in SCOPe 2.04
  
• d1zr0d_ appears in the current release, SCOPe 2.08