SCOPe 2.08: Domain d1zhhb1: 1zhh B:51-271

Lineage for d1zhhb1 (1zhh B:51-271)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein)
   Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like

6. Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (3 species)

7. Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries)
   Uniprot P54302 51-271! Uniprot P54302 52-270

8. Domain d1zhhb1: 1zhh B:51-271 [144740]
   Other proteins in same PDB: d1zhha_
   the second PAS-domain is partly disordered in the crystals
   complexed with nhe

Details for d1zhhb1

PDB Entry: 1zhh, 1.94 Å

PDB Description: Crystal Structure of the Apo Form of Vibrio Harveyi LUXP Complexed with the Periplasmic Domain of LUXQ

PDB Compounds: (B:) Autoinducer 2 sensor kinase/phosphatase luxQ

SCOPe Domain Sequences for d1zhhb1:

Sequence, based on SEQRES records:

>d1zhhb1 d.110.6.3 (B:51-271) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
rtkqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh
tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr
rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy
nvadvlqrkssdkrldkllvietpivvnavttelclltvqd

Sequence, based on observed residues (ATOM records):

>d1zhhb1 d.110.6.3 (B:51-271) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
rtkqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh
tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr
rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy
nvadvlvietpivvnavttelclltvqd

Timeline for d1zhhb1:

• d1zhhb1 first appeared in SCOP 1.75
  
• d1zhhb1 appears in SCOPe 2.07